Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
TETROSYL

TETROSYL - Carlube Petrol Injector Cleaner - 300ML

Part: TETQPI300

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£10.69

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

TETROSYL - Carlube Petrol Injector Cleaner - 300ML

The Carlube QPI300 Petrol Injector Cleaner is formulated for the discerning automotive enthusiast. The cleaner ensures your engine runs with maximum efficiency. If you're passionate about maintaining high performance and fuel economy, this product is your trusted solution. Carlube Petrol Injector Cleaner is meticulously designed to keep engines smooth, reduce emissions, and cut fuel costs. It's more than a cleaner—it's a tune-up in a bottle for your fuel system.

Features:

  • Comprehensive Cleaning: Targets carburettors, injectors, inlet ports, and valves to eliminate performance-reducing buildup.
  • Performance Enhancement: Restores injector spray patterns for smoother, more efficient engine performance.
  • Fuel Economy Boost: Reduces fuel consumption by preventing deposit formation and ensuring efficient fuel system function.
  • Emission Reduction: Helps lower exhaust emissions, contributing to a cleaner environment.
  • Engine Longevity: Protects the fuel system, extending its life and reducing maintenance needs.
  • Turbo and Converter Compatibility: Safe for use with turbochargers and catalytic converters, making it versatile for modern vehicles.

 

Application Instructions:

  • Simple Use: Add the entire bottle to a full tank of petrol—treats up to 50 litres.
  • Best Practices: For optimal results, use every 3,000 miles or at least once every six months.

 

Carlube Petrol Injector Cleaner is your ticket to peak engine performance, offering a suite of benefits designed to elevate your driving experience. By targeting and cleaning vital components such as injectors and valves, it ensures your engine runs smoothly and efficiently, optimising performance. This cleaner isn't just about performance; it also enhances fuel economy by maintaining a clean fuel system, which cuts down on fuel consumption and saves you money at the pump. Plus, it contributes to a more environmentally friendly drive by reducing emissions. Engine protection is another key advantage, as this product shields your fuel system from harmful deposits, extending engine life and slashing maintenance costs. With Carlube Petrol Injector Cleaner, you're investing in innovation and reliability, ensuring a cleaner, more efficient engine.

Fitment Info

Brand

TETROSYL

Packing Type

Bottle

Contents [ml]

300

Unique Reference

ZA039715

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!