Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

P&S

P&S - Interior Cleaner - Wipes

Part: BRNG130W

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£15.40

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

P&S - Interior Cleaner - Wipes

These versatile wipes take convenience and efficiency to a whole new level. Designed not only for cleaning vehicle interiors, they‚re perfect for wiping down multiple surfaces both inside and out. Whether you're tidying up dashboards, door panels, or leather, or tackling exterior surfaces like your polisher, tool box, or even shop equipment, Xpress Interior Wipes are your all-in-one solution for quick and easy cleanup. Keep your tools and workspace looking their best with this must-have detailing essential! Perfect for cleaning all surfaces of the interior of vehicles without the risk of damage. XPRESS Interior Wipes were developed for use on leather, vinyl and plastic. These incredible wipes clean without drying, discoloring or damaging the cleaning surface. Cleaned surfaces will feel clean and residue free. Designed for express applications, XPRESS Interior Wipes clean dirt, grease, oil and other interior traffic marks that accumulate through normal use.

Info

Brand

P&S

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!