Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

FLAVA

FLAVA - Couture Turbo Can 400ml Airfreshener CODES

Part: BRNFAS380

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£5.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

FLAVA - Couture Turbo Can 400ml Airfreshener CODES

Flava Turbo Cans deliver a high volume blast of fragrance in the home, car or at work. Turbo Cans are particularly suitable where there is a need to fill a large area quickly and effectively, leaving a fine lingering fragrance which can combat odours for long periods. Unlike typical liquid sprays, Turbo Can innovative dry mist spray leaves zero wet, sticky residue on surfaces To increase fragrance life longer it can be sprayed onto fabrics, although a test area should be tried first. Flava Turbo Cans are also suitable for commercial and industrial use, in shops, offices, factories gyms and more. Perfect for professional car valeters.

Info

Brand

FLAVA

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!