Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Solo

SOLO - Handheld Battery powered sprayer 360 B, 1.0 Litre 3,7 V / 1,4 Ah (PH RANGE 7-14)

Part: BRN36001

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£35.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SOLO - Handheld Battery powered sprayer 360 B, 1.0 Litre 3,7 V / 1,4 Ah (PH RANGE 7-14)

The SOLO 360 B rechargeable hand sprayer is a practical and universal helper for domestic and commercial cleaning and disinfecting smaller areas. The small but powerful electric pump dispenses cleaning solutions and disinfectants at the touch of a button without the need for tedious pumping. Up to 60 minutes without a charging break. Suitable for the application of alkaline, neutral to slightly acidic cleaning agents and alcohol-based disinfectant cleaners. For removing organic soiling such as grease, oil and protein residues in catering, the food processing industry, building cleaning and vehicle care, as well as for glass cleaning and surface disinfection. Sturdy, stable 1-litre container with fill level marking. The flexible suction hose in the container ensures complete application of the medium The universal nozzle is infinitely adjustable from a fine spray mist to a spot jet. Ergonomic design with easy-to-hold operating handle and smooth one-button operation. Integrated lithium-ion battery for up to 60 minutes of operation. Easy charging at any USB port Chemical-resistant components Scope of delivery: Syringe with integrated rechargeable battery and incl. USB charging cable

Info

Brand

Solo

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!