Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Solo

SOLO - Pressure Sprayer 305 B Cleaner, 5.0 Litre, with foot (PH RANGE 7-14)

Part: BRN30506

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£79.11

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SOLO - Pressure Sprayer 305 B Cleaner, 5.0 Litre, with foot (PH RANGE 7-14)

The new, exceptionally robust 305 B pressure sprayer with base from the CLEANLine range is made of sturdy, UV-resistant polyethylene and offers a fill capacity of 5 litres. Cleaning agents can be poured in easily and safely through the extra-large filling aperture. The fill level marking and semi-transparent material make an accurate reading of the fill level easy to obtain. The base gives the sprayer additional stability and its foot support facilitates pumping and opening. The container has a very robust pump and carrying handle, which makes it easy to transport the pressure sprayer when it is not being used. The SOLO 305 B pressure sprayer has a very generously dimensioned pump that requires only a few pumps to reach the maximum pressure of 3 bar. An automatic safety valve offers protection to the user and can also be used to manually depressurise the container. The very high-quality, chemical-resistant flat spray nozzle creates fine droplets that apply the cleaning agent onto the surface uniformly and quickly, in a clean, band-shaped spray pattern. The result is rapid work progress with the lowest possible consumption of cleaning agent. The CLEANLine 305 B cleaning sprayer features large, convenient control elements and includes a shoulder strap that helps you work flexibly and ergonomically. Ideal for professional cleaning and disinfection in the restaurant sector, for prewash cleaners for vehicles, for alkaline general cleaning agents, in the food-processing industry and for building cleaning services. Provides effective help in removing organic dirt, grease, oils and protein residues in kitchens and for glass cleaning. Also suitable for applying alkaline pre-cleaners and for insect removers and for alcohol-based disinfectants. Suitable for medium-sized to large surfaces.

Info

Brand

Solo

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!