Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

AUTOBRITE

AUTOBRITE - Britegel Gel Based Wheel Cleaner - 1L

Part: ATBADBGEL1L718

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£14.14

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

AUTOBRITE - Britegel Gel Based Wheel Cleaner - 1L

BRITEGEL GEL BASED WHEEL CLEANER

Effective wheel cleaning gel that removes dirt, grime & brake dust.

BriteGel is a sticky, lemon and lime-scented, non-acidic wheel cleaning gel that clings to the wheel surface enabling maximum penetration into the dirt, grime, and brake dust on your wheels. The sticky gel formula clings to the wheel and tyre with no run-off giving you increased time to clean your wheels thoroughly using less product! A powerful cleaning gel formula that provides superb foaming, powerful yet gentle cleaning, and easy rinsing.

The combined stickiness and performance certainly make Britegel the best wheel cleaner we make here at Autobrite Direct, and certainly one of the best on the market today. Its ease of use is outstanding and the impressive performance means that minimal agitation should be required to eliminate surface dirt and grime. In extreme cases, heavy baked-on brake dust may require additional agitation. BriteGel is also wax-friendly and won’t degrade your existing wheel waxes and sealants when used correctly. Dwell time is far superior to competitors thanks to our unique extra-thick gel formula, preventing drying during warmer conditions and eliminating the chance of staining on very sensitive finishes.

Britegel is ready to use and requires a heavy-duty BriteGel Trigger to dispense it. The trigger supplied provides an even,  thick mist of product ensuring total coverage on the surface with no runoff and no waste! A pH-balanced gel formula with powerful cleaning capabilities that is suitable for any wheel type and finish – even the most delicate alloy wheels on the market today such as bare metal, chrome, steel or un-protected, un-lacquered surfaces. A quick and easy way to clean your alloy wheels and tyres. BriteGel makes light work of dirt and grime,  and will transform the look of your wheels!


FEATURES

  • Powerful cleaning action for wheels and tyres
  • Sticky gel formula that sticks can dwell for extended periods
  • High foaming formula
  • pH Balanced

STEP BY STEP GUIDE

  1. Working one wheel at a time, apply BriteGel liberally and evenly to the wheel and tyre completely covered in the product.
  2. Allow the product to soften the dirt and grime, sitting for 2-3 minutes
  3. Apply BriteGel to a brush, agitating the product into the wheel and tyre
  4. Work the product into a high foam ensuring all areas are cleaned
  5. Apply BriteGel onto your brush and agitate the back rims of the wheel including behind spokes/faces and between calipers
  6. Thoroughly pressure rinse the wheel and tyre
  7. Your brushes will be black and covered in the most horrible dirt, grime and brake dust! A thorough rinse in your wheels bucket to rise off the residue and your good for next wheel
  8. Dry wheels to avoid water spotting
  9. Applying a coat of Well Dressed or Classy tyre dressing will complete the look

Info

Brand

AUTOBRITE

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!