Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

castrol

CASTROL - Brake Cleaner - 500ML

Part: CAS160A47

(1)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£3.99£4.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CASTROL - Brake Cleaner - 500ML

Experience exceptional cleaning performance with Castrol Brake Cleaner 500 ml, engineered to restore brake components to optimal condition. Renowned for quality and reliability, Castrol delivers a fast-acting formula that ensures metal brake surfaces are effectively cleaned without leaving residue.

Advanced solvent technology guarantees fast evaporation and thorough dirt removal for enhanced brake efficiency.

Features:

  • Fast Drying: Quickly evaporates without residue
  • Powerful Cleaning: Removes grease and brake dust
  • Metal Safe: Suitable for calipers, rotors, and drums
  • Low Evaporation Rate: Maximises cleaning efficiency


Trusted for precision and performance, this solution supports maintenance routines with dependable results, reinforcing confidence in every brake service. Meticulous formulation ensures consistent quality for enhanced vehicle safety and longevity.

Info

Brand

castrol

Professional-grade Degreaser

Efficiently removes oil, grease, and dirt from metal surfaces

Low Evaporation Rate

Extends cleaning time for effective residue elimination

Non-staining Formula

Leaves no marks, ensuring a clean, professional finish

Enhanced Operational Efficiency

Perfect for use in car servicing, repairs, and maintenance

Versatile Usage

Compatible with a variety of metal parts, not limited to brakes

Reliability and Precision

Designed for workshops needing dependable and precise cleaning performance

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!