Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

SEALEY

SEALEY - Baridi Slimline Freestanding Dishwasher, 45cm Wide with 10 Place Settings, 8 Programs & 5 Functions, LED Display, Silver

Part: SEADH166

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£287.98

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SEALEY - Baridi Slimline Freestanding Dishwasher, 45cm Wide with 10 Place Settings, 8 Programs & 5 Functions, LED Display, Silver

This product is not held in our Warehouse. For dispatch, please allow a minimum of 2 working days.

Slimline Design - This small dishwasher will take up less space in your kitchen with its slimmer body while still being able to easily fit larger plates, pots and pans up to 26cm in diameter.Eight Programs - Features include a Fast Wash which will leave your dishes sparkling in 60 minutes and Intensive which will remove even the toughest food residue and grease.Five Functions - Adjust the program with Express mode or Power Wash depending on how dirty your dishes are, or specify only one of the two nozzles to be active for more delicate items.Safe and secure - Features a child lock system to prevent the door from being accidentally opened mid-wash as well as a pause function so that the door can be safely opened before the cycle finishes.Perfect Positioning - Easily fit this dishwasher into your kitchen, simply remove the top to fit beneath your countertop and use the adjustable levelling feet to balance the unit.

Warranty: 1 year

Info

Brand

SEALEY

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!