Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

Cat Fitting Kit

Tu Vehículo Actual

UK
O
Seleccionar Marca
Seleccionar Modelo
Seleccionar Año
Seleccionar Motor
BMCATS

BMCATS - Fitting Kit

Parte: BAMFK92048A

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£5.35

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BMCATS - Fitting Kit

Ensure a professional and hassle-free installation with the BM Catalysts Fitting Kit, specifically designed to support seamless, efficient, and long-lasting fitting of exhaust system components.

  • All-in-One Convenience – Includes gaskets, clamps, bolts, and other key components for a full installation.

  • Perfect Fit Guarantee – Designed to complement BM Catalysts catalytic converters, DPFs, and related components.

  • Time-Saving Solution – Reduces installation effort by providing every part needed in one package.

  • Engineered for Durability – Built from quality materials to withstand heat and vibration over time.

  • Reliable Exhaust Seal – Ensures a tight, leak-free connection for long-term performance.

 

BM Catalysts Fitting Kits are the smart choice for professionals and DIYers seeking a dependable, ready-to-use solution for emission system installations.

Fitment Info

Brand

BMCATS

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!

Fitting Kit | GSF Car Parts