Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

castrol

CASTROL - Radiator Cleaner - 250ML

Parte: CAS1609C3

(1)
stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£4.78

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CASTROL - Radiator Cleaner - 250ML

The Radiator Cleaner - 250ML 8G provides a meticulous solution for maintaining and enhancing the performance of car radiators and heating systems. Specially formulated to tackle a multitude of issues, this cleaner penetrates and removes stubborn deposits, oil, and grease residue, effectively preparing your vehicle for new coolant. This powerful cleaning action is vital for restoring radiator efficiency, particularly after engine repairs or before a coolant change. 

Features:

  • Thorough Cleaning: Efficiently cleans radiators and heating systems to restore operational efficiency.
  • Residue Removal: Binds and removes oil, grease, and corrosion residues for a clean system.
  • Enhanced Coolant Protection: Prepares radiators for new coolant, ensuring older dirt doesn't compromise performance.
  • Improved Performance: Ideal for reviving reduced radiator efficiency, particularly after engine repairs.
  • Professional-Grade Solution: Trusted by retail customers and independent garages for dependable maintenance.
  • Versatile Use: Suitable for a wide range of vehicles, providing comprehensive cleaning capabilities.

 

A radiator cleaner is essential for maintaining your vehicle's optimal performance and longevity. This meticulously formulated product is designed to penetrate and dissolve tough deposits, oil, and grease from your car's radiator and heating system. 

Info

Brand

castrol

Thorough Cleaning

Effectively cleans radiators and heating systems to restore optimal function

Residue Removal

Removes oil, grease, and corrosion buildup to ensure a clean system

Enhanced Coolant Preparation

Prepares radiators for fresh coolant, preventing contamination from old deposits

Performance Improvement

Restores radiator efficiency, especially following engine repairs

Professional-Grade Solution

Relied upon by retail customers and independent garages for reliable maintenance

Versatile Application

Compatible with a broad range of vehicles for comprehensive cleaning results

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!