Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

GYEON

GYEON - Q2M Leather Cleaner Strong - 1000 ml

Parte: BRNGLCS1000R

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£23.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - Q2M Leather Cleaner Strong - 1000 ml

SUPERB MAINTENANCE PRODUCTS FOR OUTSTANDING DETAILING PERFORMANCE. Q2M LeatherCleaner Strong is an efficient and effective pre-coating leather cleaner. Developed along with Gyeon's high-end Q2 LeatherShield, it is the ultimate leather preparation product for use before a coating application. It removes dirt, oily residue and discolouration. Unlike most leather cleaners, the formula does not include any softening or preserving additives, leaving a surface ready for coating. STRONG CLEAN FOR ANY TYPE OF LEATHER Q2M LeatherCleaner Strong is the ultimate solution for cleaning and preparing leather upholstery for application of a ceramic coating. It does not contain any softening additives and does not leave any residue that could potentially interfere with a quality ceramic coating. Q2M LeatherCleaner leaves a fully matte finish and is suitable for all modern types of leather.

Info

Brand

GYEON

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!