Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

GYEON

GYEON - Q²M Interior Detailer - 1L

Parte: BRNGIND1000R

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£24.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - Q²M Interior Detailer - 1L

GYEON Q²M Interior Detailer - 1L, a must-have for those committed to maintaining the immaculate condition of their vehicle interiors with optimal hygiene. This innovative product features a cutting-edge alcohol-based formula composed of 60% alcohol, ensuring a deep, sanitising clean that effectively removes a vast majority of organic contaminants from any surface it touches. Its versatility offers a comprehensive cleaning solution for all interior surfaces, enhancing the cleanliness of your car with ease. While Q²M Interior Detailer is designed to complement rather than replace the Q²M Vinyl and Leather Cleaners, it sets a new standard in maintaining vehicle interiors by gently cleansing without compromising material integrity.

With the increased focus on hygiene, maintaining a clean environment has never been more critical. The Q²M Interior Detailer is specifically engineered to address modern hygiene demands, providing a reliable solution that ensures the health and well-being of you and your loved ones. Its powerful yet gentle formulation allows it to safely clean and disinfect a variety of materials, including leather, vinyl, and plastics, leaving a fresh, clean scent without residue.

 

Features:

  • Alcohol-Based Formula: Contains 60% alcohol for effective removal of organic contaminants.
  • Versatile Application: Safe for use on all interior surfaces, including leather, plastics, and vinyl.

  • Quick and Efficient: Delivers a thorough clean with minimal effort, ideal for regular maintenance.

  • Complementary Use: Works in harmony with Q²M Vinyl and Leather Cleaners to provide comprehensive care.

  • Fresh Fragrance: Leaves interiors smelling fresh and clean without leaving a sticky residue.

 

Invest in the GYEON Q²M Interior Detailer - 1L to achieve superior cleanliness and hygiene for your vehicle's interior. This essential product ensures your car remains a sanctuary of cleanliness and comfort, providing peace of mind on every journey.

Info

Brand

GYEON

Capacity

1L

Product Type

Interior Detailer

Formula

60% Alcohol Based

Fragrance

Fresh

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!