Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

SIMONIZ

SIMONIZ - Clear Vision Glass Cleaner 500ML

Parte: HOLSAPP0181A

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£5.39

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SIMONIZ - Clear Vision Glass Cleaner 500ML

Clear Vision Glass Cleaner

Get clear, streak-free windows and mirrors with Simoniz Clear Vision Glass Cleaner. It quickly and effectively cleans all glass, plastics, and mirrored surfaces for better visibility while you���re driving.

Simoniz Clear Vision Glass Cleaner���s rapid action formula cuts through all kinds of grease and road grime, providing maximum clarity and a streak-free finish. It can also be used around the home, quickly removing dust, dirt, and mucky marks to keep your windows and glass surfaces clean and clear.

Specification

  • Rapid grease and grime removal
  • Streak-free finish
  • Use on all glass, plastics, and mirrors
  • Will not damage rubber or silicone seals
  • Effective cleaning of grease, oily residue, fingerprints, smoke haze, and pet slobber
  • Suitable for use in your home, office, vehicle, and caravan or on any glass or mirrored surface

Info

Brand

SIMONIZ

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!