Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

P&S

P&S - Interior Cleaner - Wipes

Parte: BRNG130W

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£19.96

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

P&S - Interior Cleaner - Wipes

These versatile wipes take convenience and efficiency to a whole new level. Designed not only for cleaning vehicle interiors, they‚re perfect for wiping down multiple surfaces both inside and out. Whether you're tidying up dashboards, door panels, or leather, or tackling exterior surfaces like your polisher, tool box, or even shop equipment, Xpress Interior Wipes are your all-in-one solution for quick and easy cleanup. Keep your tools and workspace looking their best with this must-have detailing essential! Perfect for cleaning all surfaces of the interior of vehicles without the risk of damage. XPRESS Interior Wipes were developed for use on leather, vinyl and plastic. These incredible wipes clean without drying, discoloring or damaging the cleaning surface. Cleaned surfaces will feel clean and residue free. Designed for express applications, XPRESS Interior Wipes clean dirt, grease, oil and other interior traffic marks that accumulate through normal use.

Info

Brand

P&S

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!