Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

FLAVA

FLAVA - Couture Turbo Can 400ml Air Freshener SAVAGE

Parte: BRNFAS366

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£5.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

FLAVA - Couture Turbo Can 400ml Air Freshener SAVAGE

Flava Turbo Cans deliver a high volume blast of fragrance in the home, car or at work. Turbo Cans are particularly suitable where there is a need to fill a large area quickly and effectively, leaving a fine lingering fragrance which can combat odours for long periods. Unlike typical liquid sprays, Turbo Can innovative dry mist spray leaves zero wet, sticky residue on surfaces To increase fragrance life longer it can be sprayed onto fabrics, although a test area should be tried first. Flava Turbo Cans are also suitable for commercial and industrial use, in shops, offices, factories gyms and more. Perfect for professional car valeters.

Info

Brand

FLAVA

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!