Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

SEALEY

SEALEY - Baridi Slimline Freestanding Dishwasher, 45cm Wide with 10 Place Settings, 8 Programs & 5 Functions, LED Display, Silver

Parte: SEADH166

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£287.98

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SEALEY - Baridi Slimline Freestanding Dishwasher, 45cm Wide with 10 Place Settings, 8 Programs & 5 Functions, LED Display, Silver

This product is not held in our Warehouse. For dispatch, please allow a minimum of 2 working days.

Slimline Design - This small dishwasher will take up less space in your kitchen with its slimmer body while still being able to easily fit larger plates, pots and pans up to 26cm in diameter.Eight Programs - Features include a Fast Wash which will leave your dishes sparkling in 60 minutes and Intensive which will remove even the toughest food residue and grease.Five Functions - Adjust the program with Express mode or Power Wash depending on how dirty your dishes are, or specify only one of the two nozzles to be active for more delicate items.Safe and secure - Features a child lock system to prevent the door from being accidentally opened mid-wash as well as a pause function so that the door can be safely opened before the cycle finishes.Perfect Positioning - Easily fit this dishwasher into your kitchen, simply remove the top to fit beneath your countertop and use the adjustable levelling feet to balance the unit.

Warranty: 1 year

Info

Brand

SEALEY

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!