Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

INFINITY

INFINITY - Interior Detailing Kit

Part: BRNINFINITYINTERIOR

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£40.97

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

INFINITY - Interior Detailing Kit

Infinity Wax Interior Detailing Kit

Introducing the Ultimate Car Care Kit

Give your vehicle interior the ultimate makeover with our comprehensive kit, packed with a range of innovative products designed to leave your car interior looking showroom new. This all-inclusive kit is perfect for car enthusiasts who demand the best, and want to achieve professional-grade results at home.

Spotless Glass Cleaner:
Spotless is a glass cleaner is designed to effortlessly clean automotive glass both inside and out, and ensure a streak-free result every time. It's easy to miss small areas when wiping off glass cleaners, and usually, they leave a small trace of residue in these situations. That has been taken care off with Spotless Glass Cleaner.

Fresh Interior:
Fresh is a high strength alkaline interior cleaner that can be used neat or diluted according to preference. It is extremely effective at cleaning fabric seats for stain removal, carpets, and also plastic and vinyl dashboards or trim. We do not recommend using Fresh on leather, suede or Alcantara.

Fresh Interior Dressing:
Finale is a light duty cleaner and finishing spray that is designed to complement our Fresh Interior cleaner. You can use Finale on textured interior plastics, trim, and other hard surfaces. it leaves a matte finish with anti-static properties.

Interior Detailer:
Interior Detailer is a light to medium-duty cleaner that is suitable for all surfaces inside your vehicle interior, including Alcantara and leather. It also provides an anti-static effect which minimises finger marks on touch screens and glossy trim areas.

Whether you're a seasoned car enthusiast or just starting out, this kit is sure to exceed your expectations.

Info

Brand

INFINITY

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!