Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

autoglym

AUTOGLYM - Super Resin Polish 325ml

Part: AGLSRP325

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£9.98

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

AUTOGLYM - Super Resin Polish 325ml

A legend in the world of car care, used to remove minor scuffs and scratches and to restore gloss to all types of paintwork

  • The famous bottle can be found in garages all over the world, and has been lovingly applied on everything from hyper cars and priceless classics to family cars. It will not only restore gloss to dull surfaces, but is also ideal for removing small scuffs and scratches on new or old paintwork.
  • Use every few months as needed to maintain a superb shine.
  • The undefeated, 4 time winner of Detailing World’s Polish of the Year award.  

How To Use:

  1. Wash and dry the paintwork.
  2. Shake well and pour a small amount onto a polish applicator.
  3. Apply a thin layer to the paintwork in overlapping circles to ensure even coverage. Increase pressure over any marks, scratches or dull patches. Allow to dry. Do not apply to unpainted rubber or plastic trim.
  4. Buff with a cloth
  5. Stand back and admire the shine.

Q: Does Super Resin Polish contain silicone?
A: Yes, Super Resin Polish contains silicone.

Q: Does Super Resin Polish contain wax?
A: Yes, Super Resin Polish does contain a protective wax. If you would like to extend and prolong that protection, apply High Definition Wax or Extra Gloss Protection afterwards.

Q: Can I apply Super Resin Polish to unpainted plastic bumpers and trim?
A: Super Resin Polish is only suitable for painted bodywork. If any residue from Super Resin Polish comes into contact with unpainted surfaces, use Autoglym Fast Glass with a Hi-Tech Microfibre to remove this.    

Info

Brand

autoglym

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!