Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

SEALEY

SEALEY - Catalytic Converter Back Pressure Test Kit

Parte: SEAVSE953

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£57.54

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SEALEY - Catalytic Converter Back Pressure Test Kit

This product is not held in our Warehouse. For dispatch, please allow a minimum of 2 working days.

Used to establish the working condition of the catalytic converter and silencer by measuring the relative back pressure of the system. Simply connect into the exhaust system using either of the two oxygen sensor dummy adaptors supplied in the kit. Gauge features a colour-coded scale for easy diagnosis and reads both pressure and vacuum so can be used on other areas of the vehicle allowing testing of low pressure fuel systems or engine vacuum. Supplied with gauge hanging chain to allow hands-free operation.

Warranty: 1 year

Info

Brand

SEALEY

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!