Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

SEALEY

SEALEY - Catalytic Converter Back Pressure Test Kit

Part: SEAVSE953

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£43.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SEALEY - Catalytic Converter Back Pressure Test Kit

This product is not held in our Warehouse. For dispatch, please allow a minimum of 2 working days.

Used to establish the working condition of the catalytic converter and silencer by measuring the relative back pressure of the system. Simply connect into the exhaust system using either of the two oxygen sensor dummy adaptors supplied in the kit. Gauge features a colour-coded scale for easy diagnosis and reads both pressure and vacuum so can be used on other areas of the vehicle allowing testing of low pressure fuel systems or engine vacuum. Supplied with gauge hanging chain to allow hands-free operation.

Warranty: 1 year

Info

Brand

SEALEY

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!