Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

WD40

WD40 - Bike Wash - 1L

Parte: WDF44971

stock status

Disponible - Sólo colección

  • Timeline
    Entrega a Domicilio No Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£0.86£0.95

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

WD40 - Bike Wash - 1L

The WD-40 Bike Wash is a high-performance solution engineered to tackle the most challenging dirt, oil, and grime that can accumulate on your bike. This fast-acting spray cleaner, available in a convenient 1-litre bottle, is an essential addition to the toolkit of any serious cyclist, mechanic, or bike enthusiast. Designed with precision, this powerful formula cleans all surfaces with ease, ensuring your bike maintains its optimal appearance and performance. Crafted with attention to environmental considerations, the WD-40 Bike Wash is safe for use on all bike components, including metal, plastic, rubber, and carbon fibre. It's gentle on your bike yet uncompromising on dirt, providing a thorough clean without damaging delicate surfaces. The easy-to-use spray application ensures complete coverage, reaching those hard-to-access areas for a comprehensive cleanse.

Features:

  • Comprehensive Cleaner: Effectively removes dirt, oil, and grime from all bike surfaces.
  • Fast-Acting Formula: Rapidly cuts through tough contaminants for a faster clean.
  • Versatile Use: Suitable for use on metal, plastic, rubber, and carbon fibre components.
  • User-Friendly Design: 1-litre bottle with spray nozzle ensures easy application.
  • Safe for All Components: Gentle on all bike parts, ensuring no damage to surfaces.
  • Efficient Cleaning: Minimises cleaning time, maximising your riding time.
  • Rinse-Free Application: Leaves no residue, ensuring a spotless finish.
  • Eco-Friendly: Formulated with environmental considerations for conscientious cleaning.

 

Regular washing with WD-40 Bike Wash not only removes surface dirt and grime but also plays a pivotal role in preventing potential corrosion and wear. By efficiently clearing contaminants, this product helps safeguard critical components such as chains, gears, and cables from premature damage, ensuring continued peak performance. The fast-acting formula is designed to minimise your cleaning effort, allowing more time to enjoy the ride without compromising on thoroughness. The extensive reach of WD-40's product line signifies a commitment to delivering superior bike care solutions trusted by retail customers, independent garages, and national chains alike. Featuring a versatile application suitable for all bike surfaces, including metal, plastic, rubber, and carbon fibre, the WD-40 Bike Wash stands out for its unparalleled ability to clean without causing damage. This focus on safety and efficacy reflects WD-40's role as a trusted advisor and reliable partner in maintaining cleanliness and performance.

Info

Brand

WD40

Volume

1L

Features

Fast acting spray cleaner and great on all surfaces, leaves no residue ensuring a spotless finish

Fast acting formula

Rapidly cuts through tough contaminants for a faster clean

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!