20% OFF CAR PARTS

Usar Código: AUG20

La Oferta Expira en:

00

MM

00

SS

Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

meguiars

MEGUIARS - Ultimate Quik Wax - 473ml

Parte: MEGG200916EU

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£14.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MEGUIARS - Ultimate Quik Wax - 473ml

Meguiar’s Ultimate Quik Wax is a testament to the brand's dedication to delivering cutting-edge car maintenance solutions for a wide-ranging audience, from retail customers to independent garages and national chains. Its innovative formula, powered by Meguiar’s Hydrophobic Polymer Technology, delivers a deep, wet-look gloss that mirrors the level of care and detail typically reserved for professional automotive services. The Ultimate Quik Wax is specifically designed to provide an effortless application process, even when used in full sun, with no risk of pesky whitening residue that can spoil a perfect finish.

 Features:

  • Hydrophobic Polymer Technology: Provides long-lasting water beading action, keeping vehicles protected even in adverse weather.
  • Efficient Application: Easy spray-on, wipe-off formula ensures rapid application without the need for specialised equipment.
  • Clear Coat Safe: Safe to use on all paint types, ensuring comprehensive vehicle care without the risk of damage.
  • Professional Finish: Delivers a high-gloss, deep wet-look shine comparable to traditional waxing methods.
  • Non-Whitening Formula: Avoids unsightly residue, perfect for all vehicle colours.
  • Sunlight-Friendly: Applies effectively even in full sun, broadening the possible conditions for use.
  • Trusted Brand: Part of the extensive Meguiar’s product range, known for superior quality and innovation.
  • Versatile Use: Works seamlessly for various users, from individual car enthusiasts to large automotive operations.
  • Cost-Effective Maintenance: Extends the life of prior wax applications, reducing the need for frequent waxing.
  • Enhanced Sprayer Design: Offers a uniform mist, ensuring even coverage and optimal results.

 

Quik Wax is an invaluable asset for anyone dedicated to maintaining their vehicle's aesthetic and performance integrity. Meguiar's Ultimate Quik Wax exemplifies the brand's commitment to quality, offering an efficient solution that caters to retail customers, independent garages, and national chains alike. This product integrates seamlessly into any car care routine with its advanced Hydrophobic Polymer Technology, ensuring a long-lasting, glossy finish that repels water and environmental contaminants

 

 

 

 

 

Info

Brand

meguiars

Volume

473ml

New Polymer Chemistries

Leaves behind a longer-lasting protective barrier

Easy to use

Easy on and even easier wipe off than the previous formula, even in the full sun

Shine and slickness

Paint comes alive with deep, wet-look reflections and a super slick finish

Enhanced sprayer

All-new sprayer provides a uniform mist that atomises to perfection

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!