Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

meguiars

MEGUIARS - Ultimate Black Plastic Restorer - 355ml

Parte: MEGG15812EU

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£14.45

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MEGUIARS - Ultimate Black Plastic Restorer - 355ml

Designed to rejuvenate the exterior plastic, vinyl, and rubber trims of vehicles, this product transforms worn surfaces to a like-new appearance with a rich darkness and shine. Leveraging breakthrough UV clear coat technology, it provides superior protection against the harsh effects of sun-induced fading and degradation, ensuring that your vehicle's trims remain vibrant. Its non-greasy formula dries rapidly, preventing residue that can attract dirt or grime, which makes it ideal for all weather conditions. Easy to apply with a Meguiar's X2020EU Supreme Shine Microfibre, this restorer ensures a smooth and even finish, offering convenience and efficiency to both independent garages and national chains. Moreover, it addresses the critical need for longevity by preventing aging signs and shielding surfaces from environmental contaminants, thus extending the life of your vehicle’s exterior components. Whether used on bumpers, mouldings, door handles, or other external details, Meguiar's Ultimate Black Plastic Restorer emerges as an all-in-one solution, solidifying its place as a trusted partner in automotive care.

Features:

  • Revives Exterior Surfaces: Meguiar's Ultimate Black Plastic Restorer is designed to rejuvenate exterior plastic, vinyl, and rubber trims, transforming worn surfaces to look like new.
  • Advanced UV Protection: Utilising breakthrough UV clear coat technology, this product offers superior protection against sun-induced fading and degradation.
  • Durable and Long-Lasting: With its extended durability, this trim dressing provides a lasting solution that outperforms traditional protectants, maintaining its effect for weeks.
  • Non-Greasy Formula: The innovative formula dries quickly without leaving a greasy residue, ensuring a clean application that won't attract dirt or grime.
  • Streak-Free in All Weather: Specifically formulated to resist streaking even after exposure to rain or during washing, keeping your vehicle looking pristine.
  • Easy Application: The product can be applied effortlessly with a Meguiar's X2020EU Supreme Shine Microfibre, ensuring a smooth and even finish every time.
  • Rich Darkness and Shine: Meguiar’s Ultimate Black enhances the richness and shine of your car's trims, making them appear vibrant and new.
  • Prevents Aging: It not only restores but also actively prevents aging signs, extending the life of your vehicle’s exterior components.
  • Protects Against Contaminants: The protective layer created by this restorer shields surfaces from harmful environmental contaminants and pollutants.
  • All-in-One Solution: Ideal for use on bumpers, mouldings, door handles, rear-view mirrors, and windscreen cowlings, offering a comprehensive restoration for all your car’s exterior details.

 

This product not only revives and enhances the aesthetic appeal of a vehicle by transforming faded trims to their original lustrous state but also extends the life of these components. With advanced UV protection at its core, it shields surfaces from the damaging effects of prolonged sun exposure and environmental pollutants. This ensures a vehicle's exterior remains pristine and well-maintained, reflecting a commitment to both quality and longevity. The confidence this product instills in users—from retail customers seeking to maintain their personal vehicles to independent garages and national chains aiming to deliver exceptional service—solidifies its reputation as an industry leader. The ease of application and versatility across various vehicle components further underscore its crucial role as a trusted partner in automotive restoration and protection, making it an essential tool for anyone looking to uphold the highest standards in vehicle care.

 

Info

Brand

meguiars

Volume

355ml

Type

Black Plastic Restorer

Applications

Exterior plastic, vinyl and rubber trim

Additional info

The ultimate in long lasting UV protection, sries fast, is non greasy and returns your plastics back to black

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!