24% OFF CAR PARTS

Use Code: PAY24

Offer Expires in:

00

MM

00

SS

Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
PETRONAS

PETRONAS - Syntium 5000 DM 5w30 C2 C3 1L

Part: PET70644E18EU

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£7.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

PETRONAS - Syntium 5000 DM 5w30 C2 C3 1L

PETRONAS Syntium 5000 DM 5W-30 is specially formulated to provide outstanding protection for the engines equipped with exhaust gas after treatment systems running under the most extreme & demanding driving conditions. It is formulated through our extensive collaboration experience with major European car manufacturers, coupled with fully synthetic and environmentally friendly mid SAPS lubricant technology to provide optimum thermal and oxidation stability. It delivers fuel economy and yet effectively protects the exhaust gas after treatment systems of your cars. PETRONAS Syntium 5000 DM 5W-30 is a mid SAPS engine oil that is suitable for Mercedes-Benz vehicles with both gasoline and diesel engines (equipped with exhaust gas after treatment systems) and latest high-performance cars, SUVs and light vans fitted with emission control devices such as diesel particulate filters and catalytic converters, modern electronic fuel injected and multi-valve technology engines and turbochargers or superchargers operating under most severe conditions.  The oil is also compatible with the use of biofuels. The experience gathered by PETRONAS on the F1 circuits and most important motoring events and competitions has enabled the development of PETRONAS Syntium; a range of hi-tech lubricants capable of meeting the needs of new generation engines – both on track and on the road.

Note: Always consult your owner’s manual to check recommended viscosity grade and specifications for your particular vehicle.

Features:

  • Excellent protection to exhaust gas after treatment systems for Mercedes engines.
  • Excellent engine deposits and wear reduction, hence delivering maximised engine responsiveness.
  • Excellent thermal stability, able to protect against high temperature induced sludge and varnish for ultimate engine power and engine cleanliness.
  • Fuel economy.
  • Longer oil drain capability up to maximum specified by manufacturers.
  • Instant start-up lubrication.

 

Meets or Exceeds the requirements of: API SN, ACEA C3 / C2

Has the following builder approvals: MB-Approval 229.52, MB-Approval 229.51, Dexos 2, Renault RN0700

Meets or Exceeds the following builder requirements: BMW Longlife-04, PSA B71 2290, VW502 00 / 505 00 / 505 01

 

Choosing a high-quality engine oil is crucial for maintaining your vehicle's peak performance and longevity. Premium engine oils provide excellent lubrication, which minimises friction among moving components. This reduction in friction not only prevents wear and tear on the engine but also enhances fuel efficiency, yielding long-term cost savings. High-quality oils possess quality thermal stability and viscosity, ensuring optimal engine performance across a broad range of temperatures and driving conditions. Furthermore, they effectively disperse contaminants and help maintain engine cleanliness, preventing sludge buildup that can impair engine function. By investing in a quality engine oil, you are ensuring the reliability and efficiency of your vehicle, avoiding potential breakdowns, and experiencing a smoother, more responsive drive.

 

Fitment Info

Size

1L

ACEA

C2, C3

Brand

PETRONAS

Grade

5W-30

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!