Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

CATACLEAN

CATACLEAN - Petrol Catalytic Cleaner - 500ML

Part: CAT001

(7)
Guarantee Badge Icon

Money Back Guarantee

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£17.48

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CATACLEAN - Petrol Catalytic Cleaner - 500ML

Experience enhanced engine efficiency and cleaner exhausts with CATACLEAN® Petrol 500ml, a premium fuel and exhaust system cleaner designed to elevate vehicle performance. Trusted for its high-quality formulation, this advanced cleaner helps maintain optimal running conditions and prolongs engine life.

Patented 8-in-1 technology optimises fuel delivery and reduces harmful emissions effectively.

Features:

  • Removes Carbon Build-Up: Clears valves and injectors
  • Boosts Fuel Economy: Improves mileage efficiency
  • Reduces Emissions: Cuts harmful pollutants by up to 60%
  • Protects Catalytic Converter: Maintains exhaust system health
  • Prevents MOT Failures: Helps pass emissions tests


Engineered for reliability, this formulation supports long-term vehicle care by enhancing combustion and exhaust cleanliness. It ensures consistent engine responsiveness while promoting environmental responsibility through emission reduction.

Info

Size

500ML

Brand

CATACLEAN

Application

Petrol

Warranty Guaranteed Text

Money Back Guarantee

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!