Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

O2 Sensor

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
ngk

NGK - Lambda Sensor - 950mm

Part: NGKOZA836-EE13

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£70.31£92.51

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

NGK - Lambda Sensor - 950mm

The NGK Lambda Sensor, NGKOZA836-EE13, isn't just another component; it's your vehicle's key to unlocking top-tier performance and sustainability. This precision instrument measures the air-fuel mixture with pinpoint accuracy, ensuring your engine runs at its best. Balancing the air-to-fuel ratio is essential not just for performance, but for the life of your catalytic converter. By optimising these conditions, the Lambda Sensor helps reduce harmful emissions significantly, paving the way for a cleaner planet.

Features:

  • Optimise Engine Performance: Ensures precise air-fuel balance for maximum efficiency.
  • Reduce Emissions: Cuts down harmful pollutants, contributing to a greener environment.
  • Enhance Fuel Economy: Enjoy savings with efficient fuel usage.
  • Extend Catalytic Converter Life: Maintains ideal conditions, prolonging converter lifespan.
  • Easy Installation: Quick and hassle-free integration into existing systems.

 

The lambda sensor plays a crucial role in modern automotive systems by ensuring efficient and optimal engine performance. It accurately measures the air-fuel ratio during combustion, allowing the engine control unit to adjust the mixture for peak efficiency. This precision not only enhances fuel economy but also reduces harmful emissions, supporting environmental sustainability. By maintaining the correct air-fuel balance, the lambda sensor extends the life of both the catalytic converter and the engine itself. Its integration into vehicle diagnostics highlights potential issues early, saving on costly repairs.

Fitment Info

Brand

ngk

Lambda Sensor

Heated

Number of circuits

4

Length [mm]

950

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!