20% OFF CAR PARTS

Usar Código: AUG20

La Oferta Expira en:

00

MM

00

SS

Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

meguiars

MEGUIARS - Hot Rims Wheel and Tyre Cleaner - 710ML

Parte: MEGG9524EU

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£12.95

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MEGUIARS - Hot Rims Wheel and Tyre Cleaner - 710ML

With Meguiar's Hot Rims All Wheel & Tyre Cleaner, achieving a pristine finish for your vehicle’s wheels and tyres has never been easier. This powerful formula is specifically engineered to target stubborn grime and contaminants, making it the ideal choice for car enthusiasts and professionals alike. The Xtreme Cling™ foam technology ensures that the cleaner adheres to vertical surfaces efficiently, offering an immersive cleaning experience that commands authority over dirt and debris. From retail customers maintaining their vehicles at home to independent garages and national chains seeking reliable cleaning solutions, Meguiar's Hot Rims stands out with its proven performance. Its ability to dissolve contaminants without compromising the integrity of clear-coated wheels underscores the brand’s commitment to quality and longevity.

Features:

  • Xtreme Cling™ Foam: Adheres to wheels and tyres for thorough cleaning without runoff.
  • Safe for All Wheels: Compatible with all clear-coated wheel finishes.
  • Removes Stubborn Contaminants: Effectively dissolves dirt, dust, and brake residue.
  • Enhances Wheel Appearance: Leaves a brilliant shine that showcases your vehicle’s wheels.
  • User-Friendly Application: Easy to use, requiring minimal effort for maximum results.
  • Versatile Use: Suitable for all types of wheels and tyres, broadening its usability.
  • Professional-Grade Formula: Employs trusted technology for superior cleaning performance.
  • Trusted Brand: Part of Meguiar’s renowned lineup of car care solutions.
  • Perfect for All Users: Designed to meet the needs of retail customers, garages, and national chains.
  • Long-Lasting Results: Offers sustained cleanliness and shine, minimising frequency of use.

 

Using a quality wheel and tyre cleaner is vital for maintaining both the aesthetic appeal and functional integrity of a vehicle. Wheels and tyres encounter the harshest conditions, from road grime and brake dust to extreme weather, making them prone to damage and wear. A dedicated cleaner like Meguiar's Hot Rims Wheel & Tyre Cleaner provides a comprehensive solution by effectively dissolving stubborn contaminants, ensuring the preservation of clear-coated finishes. For retail customers, this translates to a lasting shine that enhances the vehicle's overall look,

 

 

Info

Brand

meguiars

Volume

710ml

Additional info

Suitable for all clear-coated wheels

Additional info 2

Powers through brake dust and grime on wheels and tires

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!