Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

castrol

CASTROL - DPF Cleaner - 400ML 8G

Part: CAS1609A0

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£9.88

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CASTROL - DPF Cleaner - 400ML 8G

The DPF Cleaner - 400ML 8G Aerosol emerges as a premier choice for workshops and automotive professionals seeking to maintain and enhance diesel particulate filter (DPF) performance. This high-quality cleaning spray is expertly formulated to dissolve carbon deposits in particle filters, ensuring that DPF systems operate at their optimal capacity. With a specialised neutral formula devoid of metal or ash, the DPF Cleaner provides an efficient cleaning process that leaves no residue, eliminating the need for subsequent cleaning or disassembly of the DPF. 

Features:

  • Efficient Carbon Dissolution: Expertly dissolves carbon deposits, enhancing filter performance.
  • Residue-Free Formula: The cleaner evaporates completely, eliminating the need for additional cleaning steps.
  • No Disassembly Required: Simplifies the maintenance process, saving time and labour.
  • Neutral Composition: Free from metals and ash, ensuring compatibility with all DPF systems.

 

Maintaining a clean diesel particulate filter (DPF) is essential for the optimal performance and longevity of diesel engines. A high-quality DPF cleaner, such as the DPF Cleaner - 400ML 8G Aerosol, plays a critical role in removing stubborn carbon deposits that accumulate over time, ensuring that vehicles continue to operate efficiently and comply with emission standards. By using a DPF cleaner, you eliminate the need for exhaustive manual cleaning or expensive replacements, as its effective formula works directly within the system to restore filter functionality. 

Info

Brand

castrol

Efficient Carbon Dissolution

Effectively breaks down carbon buildup to improve filter efficiency

Residue-Free Formula

Evaporates fully, removing the need for extra cleaning procedures

No Disassembly Needed

Streamlines maintenance by eliminating the requirement to take apart components

Neutral Composition

Contains no metals or ash, making it safe for use with all DPF systems

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!