Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

POWATEC

POWATEC - Complete Diesel System Cleaner - 375ML

Part: PWTPWT2101

(1)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£7.69£9.59

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWATEC - Complete Diesel System Cleaner - 375ML

POWATEC Complete Diesel System Cleaner (PWT2101) – Advanced Fuel Additive for High-Pressure Diesel Engines

Maintain peak engine performance and fuel efficiency with POWATEC Complete Diesel System Cleaner (PWT2101) – a high-tech diesel additive engineered for modern high-pressure direct injection diesel engines, including those with common rail or pump-injector systems. Developed from extensive research and designed to meet the exacting standards of today’s advanced diesel engines, this professional-grade cleaner is particularly recommended for vehicles with extended service intervals and offers complete protection across the fuel system.

Formulated to exceed the requirements of DIN EN ISO 12156-1 (HFRR test), POWATEC’s diesel system cleaner ensures superior lubrication of critical engine components, especially within the high-pressure pump. It actively removes even the smallest particles of contamination, restores optimum fuel atomisation, and supports cleaner, more efficient combustion. Additionally, it eradicates water bubbles in the fuel and safely absorbs moisture, protecting your diesel system from corrosion and injector damage. Compatible with engines equipped with diesel particulate filters (DPF), turbochargers, and catalytic converters, this additive can be poured directly into the fuel tank or used via specialised cleaning equipment. One 375ml bottle treats up to 80 litres of diesel with a 1:200 mixing ratio, making it a cost-effective and efficient solution for professional-grade engine maintenance.

 

Features:


  • Removes even the smallest particles of contamination – Keeps injectors and fuel pathways clean for better engine response.

  • Provides for optimum atomisation and fuel efficiency – Enhances combustion quality and reduces emissions.

  • Guarantees total lubrication of the whole system, especially in the high-pressure pump – Prevents wear and extends engine component life.

  • Eradicates water bubbles in the fuel and absorbs dangerous moisture – Protects against corrosion and injector damage.

  • Exceeds DIN EN ISO 12156-1 (HFRR test) – Tested to meet and surpass strict industry lubrication standards.

  • Recommended for engines with DPF, turbo, and catalytic converter – Safe for use in modern diesel powertrains.

  • 375ml treats up to 80 litres of diesel – High-performance formula with economical dosing.



Modern diesel engines operate under extreme pressure and require clean, well-lubricated fuel systems to function efficiently and reliably. POWATEC Complete Diesel System Cleaner offers comprehensive protection by cleaning, lubricating, and restoring critical components, preventing costly repairs and performance issues. It is a crucial tool for maintaining fuel economy, reducing emissions, and prolonging engine life—making it an essential additive for any diesel vehicle owner or service professional.

Info

Brand

POWATEC

Capacity

375ml

Mixing Ratio

1:2000

Max volume to treat

80 litres

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!