Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

GYEON

GYEON - 5PC Detailing Kit

Parte: BRNGYEON01

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£56.49

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - 5PC Detailing Kit

Gyeon Detailing Kit: Complete Care for Your Car

Transform your car's appearance and protect its surfaces with the comprehensive Gyeon Detailing Kit. Designed for car enthusiasts and professionals alike, this kit contains everything you need to achieve a showroom finish and maintain it effortlessly.

What's Inside:

  1. Gyeon Glass 500ml - Glass is the ultimate formula for fast, effortless and effective cleaning of all automotive glass surfaces. Removes oily residue and instantly leaves a smudge free finish.

  2. Gyeon Tire Cleaner 500ml - A specialised and highly effective tyre and rubber cleaner. Removes old dressings and deep, accumulated contamination with ease. Q²M TireCleaner is safe on all types of tyres, including classic white-wall rubber.

  3. Gyeon Bug & Grime 500ml - Bug&Grime is a strong and very efficient pre-wash product developed specially for the removal of insects, bugs and grime.

  4. Gyeon Bathe 500ml - pH neutral shampoo 

  5. Gyeon Interior Detail 500ml - InteriorDetailer has an alcohol-based formula, which removes the majority of organic contaminants from any surface.

With the Gyeon Detailing Kit, you can achieve professional-grade results and keep your car looking its best. Whether you're preparing for a car show or simply want to enjoy a spotless ride, this kit has you covered.

Info

Brand

GYEON

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!