Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

BigBoi

BIGBOI - Surface Cleaner

Parte: ULFPREPR

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£27.48

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BIGBOI - Surface Cleaner

The Clean Slate – Strip. Prep. Protect. Flawlessly

BigBoi PrepR Surface Cleaner is the detailer’s secret weapon – a silicone-free, industrial-strength surface cleaner that annihilates waxes, polishing oils, and grease without a trace. Designed for ceramic coating prep, paint correction, or show-car final touches, it leaves surfaces hospital-clean for maximum product bonding. Safe on paint, glass, wheels, and bare metal, it’s the last wipe before perfection.

Why Choose PrepR?

✔ Prepping for ceramic coating? Bare-surface clean ensures proper adhesion.
✔ Fighting oily residue? 1–2 sprays dissolve polish/wax in seconds.
✔ Hate streaks? Zero-silicone formula leaves nothing behind.
✔ Body shop safe? Won’t contaminate paint before resprays.

Features

  • Heavy-Duty Degreaser: Removes waxes, sealants, and silicone
  • Multi-Surface Safe: Paint, glass, metal, wheels, and trim
  • No Residue: Unlike IPA, won’t flash-evaporate or streak
  • Pro-Approved: Used by ceramic installers and body shops

Specifications

  • Size: 500ml (16.9 fl oz) – 100+ panels
  • pH Level: 9.0 (strong but non-etching)
  • Fragrance: Odourless (no masking scents)
  • Origin: Australian-made

How To Use

  • Shake: Activate cleaning agents
  • Spray: 1–2 mists on microfiber (not directly on surface)
  • Wipe: Single pass with light pressure
  • Final Pass: Dry towel to ensure zero residue

 

Info

Brand

BigBoi

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!