Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

Koch-Chemie

KOCH-CHEMIE - FSE Quick Detailer 1L

Parte: MOEK285001

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£11.23

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

KOCH-CHEMIE - FSE Quick Detailer 1L

All-round detailing spray for fast care of all external vehicle surfaces such as paintwork, glass and plastics. With its special formula even stubborn limescale stains are removed quickly and without leaving any residue. Maintains and preserves in a single step. Depth of colour is returned leaving a smooth brilliant high gloss free from streaks. Finish Spray exterior is quickly removed, is easy to use and protects the surfaces against new dirt.

Recommendations for use Use the spray bottle to apply evenly to the areas to be treated and polish off with a Profi microfibre cloth.

Areas of use External surfaces of vehicles (paintwork, glass, plastic)

Info

Brand

Koch-Chemie

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!