Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

HOLTS

HOLTS - Brake Cleaner

Parte: HOLHMAI0202A

(4)
stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£19.50

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

HOLTS - Brake Cleaner

Experience superior cleaning performance and confidence in every application with the trusted quality of HOLTS Brake Cleaner. Engineered for both professionals and enthusiasts, this essential formulation delivers powerful results that help maintain peak braking efficiency and vehicle safety. Choose a solution designed to tackle tough contaminants and preserve the integrity of your vehicle, with the reliability that comes from a renowned name in automotive care.

Advanced rapid-evaporation technology supports hassle-free maintenance.

Features:

  • Fast-drying formula: Leaves surfaces spotless in moments
  • Non-corrosive action: Safeguards delicate components
  • Penetrates tough grime: Dissolves oil, dust, and residue
  • No residue left: Ensures clean, smooth operation


Trusted by garages and motorists alike, this solution is crafted to enhance maintenance routines and provide peace of mind wherever the road leads. Engineered for performance and formulated for safety, it stands as a benchmark in vehicle upkeep without compromise.

Info

Brand

HOLTS

Capacity [Litre]

5

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!