Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Cat Fitting Kit

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
BMCATS

BMCATS - Fitting Kit

Part: BAMFK92036A

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£12.26

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BMCATS - Fitting Kit

Ensure a professional and hassle-free installation with the BM Catalysts Fitting Kit, specifically designed to support seamless, efficient, and long-lasting fitting of exhaust system components.

  • All-in-One Convenience – Includes gaskets, clamps, bolts, and other key components for a full installation.

  • Perfect Fit Guarantee – Designed to complement BM Catalysts catalytic converters, DPFs, and related components.

  • Time-Saving Solution – Reduces installation effort by providing every part needed in one package.

  • Engineered for Durability – Built from quality materials to withstand heat and vibration over time.

  • Reliable Exhaust Seal – Ensures a tight, leak-free connection for long-term performance.

 

BM Catalysts Fitting Kits are the smart choice for professionals and DIYers seeking a dependable, ready-to-use solution for emission system installations.

Fitment Info

Brand

BMCATS

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!